PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012051-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 277aa    MW: 30852.8 Da    PI: 6.8438
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012051-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g+ R++k+c++rw +yl
    NNU_012051-RA 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.45.8e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
    NNU_012051-RA  70 LTEAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-20563IPR009057Homeodomain-like
PROSITE profilePS5129412.711961IPR017930Myb domain
SuperFamilySSF466896.36E-2711108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-141461IPR001005SANT/Myb domain
CDDcd001674.24E-91661No hitNo description
PROSITE profilePS5129427.76462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2564116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1569111IPR001005SANT/Myb domain
CDDcd001677.18E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TEAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLTKMG  120
IDPVTHEPLH KHAATTTATQ VTSSITSADR HPDSSKKTLR LPSPENNGRL TTPDQENSSS  180
AAENCSGDES RLSDNNGGQG SLMSCLLWGD DKPLVEASWK FPTTSAGETY NDVGSLSWEE  240
NCAWLLDYQD FGVEEFGFGC FNDIAMDMST LEMGDKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264189.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-109ODO1_PETHY; Protein ODORANT1
TrEMBLD7UEC11e-128D7UEC1_VITVI; Putative uncharacterized protein
STRINGVIT_00s1241g00010.t011e-128(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.18e-94myb domain protein 42